Protein coding transcript 211231

• Transcript: Ll_transcript_61222
• CDS coordinates: 1025-1495 (+)
• Peptide sequence: MLKTVLIEPTSGNTGIGLAFMAAAKGYKLIITMPASMSLERRIILLAFGAQLVLTDPAKGMKGAVQKAEEILAKTPNAYILQQFENPANPKVHYETTGPEIWKGTEGKIDALVSGIGTGGTITGAGKYLKEQNSNIKLIGVEPVESPVLSGGKPGV*
• ORF Type: complete

Annotations of Ll_transcript_61222

• Blastp: Cysteine synthase from Brassica with 86.27% of identity
• Blastx: Cysteine synthase from Brassica with 86.27% of identity
• Eggnog: -
• Kegg: -
• CantataDB: Link to cantataDB annotations (CNT0001535)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019444553.1)
• Pfam: Pyridoxal-phosphate dependent enzyme (PF00291.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;