Protein coding transcript 211239

• Transcript: Ll_transcript_61249
• CDS coordinates: 331-1125 (+)
• Peptide sequence: MWCYLLILKSVLIEPTSGNTGIGLAFLAAAKGYKLIITMPASMSLERRTILLSFGAELVLTDPAKGMKGAVQKAEEILAKTPNAYMLQQFENPANPKVHYETTGPEIWKGTDGKIDALVSGIGTGGTITGAGKFLKEQNPNIKLYGVEPVESPVLSGGKPGPHKIQGIGAGFIPGVLDVNLLDEVVQISSTEAIETAKQLALNEGLFVGISSGAAAAAAIKIAKRPENAGKLIVAVFPSFGERYLSSVLFESVRKEAESLTFEP*
• ORF Type: complete

Annotations of Ll_transcript_61249

• Blastp: Cysteine synthase from Citrullus with 87.11% of identity
• Blastx: Cysteine synthase from Citrullus with 87.11% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (BAA05965)
• CantataDB: Link to cantataDB annotations (CNT0001535)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019427530.1)
• Pfam: Pyridoxal-phosphate dependent enzyme (PF00291.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;