Transcript | Ll_transcript_61255 |
---|---|
CDS coordinates | 1025-1498 (+) |
Peptide sequence | MLKTVLIEPTSGNTGIGLAFMAAAKGYKLIITMPASMSLERRIILLAFGAQLVLTDPAKGMKGAVQKAEEILAKTPNAYILQQFENPANPKVHYETTGPEIWKGTEGKIDALVSGIGTGGTITGAGKYLKEQNSNIKLIGVEPVESPVLSGGKPGES* |
ORF Type | complete |
Blastp | Cysteine synthase from Brassica with 86.27% of identity |
---|---|
Blastx | Cysteine synthase from Brassica with 86.27% of identity |
Eggnog | - |
Kegg | - |
CantataDB | Link to cantataDB annotations (CNT0001535) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019444553.1) |
Pfam | Pyridoxal-phosphate dependent enzyme (PF00291.24) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer