Protein coding transcript 211251

• Transcript: Ll_transcript_61236
• CDS coordinates: 1025-1684 (+)
• Peptide sequence: MLKTVLIEPTSGNTGIGLAFMAAAKGYKLIITMPASMSLERRIILLAFGAQLVLTDPAKGMKGAVQKAEEILAKTPNAYILQQFENPANPKVHYETTGPEIWKGTEGKIDALVSGIGTGGTITGAGKYLKEQNSNIKLIGVEPVESPVLSGGKPGPHKIQGIGAGFVPGVLEVNILDEVVQISSDDAIETAKLLALKEGLFVGISSGAAAAAAIKIAKRP
• ORF Type: 3prime_partial

Annotations of Ll_transcript_61236

• Blastp: Cysteine synthase from Spinacia with 87.16% of identity
• Blastx: Cysteine synthase from Citrullus with 86.24% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019444553.1)
• Pfam: Pyridoxal-phosphate dependent enzyme (PF00291.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;