Protein coding transcript 211255

• Transcript: Ll_transcript_61377
• CDS coordinates: 151-507 (+)
• Peptide sequence: MASTLSVTAHLSDIHGPTERKNLPSFSNPLCKLNSSANIVDMKIFSRHGCQKLRLHHRCFQVHALFGGKKENNDKSDDASSKAGILGNMQNLFETVKKAQMVVQVEAVRVQKELASRV*
• ORF Type: complete

Annotations of Ll_transcript_61377

• Blastp: Nucleoid-associated protein At4g30620, chloroplastic from Arabidopsis with 71.67% of identity
• Blastx: Nucleoid-associated protein At2g24020, chloroplastic from Arabidopsis with 86.25% of identity
• Eggnog: Binds to DNA and alters its conformation. May be involved in regulation of gene expression, nucleoid organization and DNA protection (By similarity)(COG0718)
• Kegg: Link to kegg annotations (AT4G30620)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019441614.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;