Transcript | Ll_transcript_61383 |
---|---|
CDS coordinates | 70-387 (+) |
Peptide sequence | MKIFSRCRGCRKVGLHHKCFRVHALFGGKKENNDKSDDAPSKAGMLGNMQNLFDTVKKAQMVVQVEAVRVQKELAVAEFDGYCEGELIKVRYLLSPYLSHTYAVC* |
ORF Type | complete |
Blastp | Nucleoid-associated protein At4g30620, chloroplastic from Arabidopsis with 68.75% of identity |
---|---|
Blastx | Nucleoid-associated protein At4g30620, chloroplastic from Arabidopsis with 68.75% of identity |
Eggnog | Binds to DNA and alters its conformation. May be involved in regulation of gene expression, nucleoid organization and DNA protection (By similarity)(COG0718) |
Kegg | Link to kegg annotations (AT4G30620) |
CantataDB | Link to cantataDB annotations (CNT0000414) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019463223.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer