Protein coding transcript 211329

• Transcript: Ll_transcript_59839
• CDS coordinates: 414-743 (+)
• Peptide sequence: MQDLLLNQKEAMYGSKPSPRKSNSFRTTNGYRANGNGTASVPPTPRRSSVSGGTSEVHTPHSFSGRQNGYHKEMRRLSTAPLTNYVAISKEDTLSYASLCGSDESPPLG*
• ORF Type: complete

Annotations of Ll_transcript_59839

• Blastp: 65-kDa microtubule-associated protein 7 from Arabidopsis with 61.26% of identity
• Blastx: 65-kDa microtubule-associated protein 7 from Arabidopsis with 56.57% of identity
• Eggnog: protein regulator of cytokinesis(ENOG410YZBK)
• Kegg: Link to kegg annotations (AT1G14690)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019460648.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;