Transcript | Ll_transcript_60971 |
---|---|
CDS coordinates | 831-1244 (+) |
Peptide sequence | MTGCVILFPIAITFYITWWFIHFVDGFFSPIYAQLGIEVFGLGFVTSITFIFVVGVFMSSWLGASVLGLGEWFIKRMPLVRHIYNASKQISAAISPDQNSQAFKEVAIIRHPRVGEYAFGFITSSVVLQVSFGRYVW* |
ORF Type | complete |
Blastp | Protein CONTINUOUS VASCULAR RING 1 from Arabidopsis with 91.47% of identity |
---|---|
Blastx | Protein CONTINUOUS VASCULAR RING 1 from Arabidopsis with 90.58% of identity |
Eggnog | conserved protein(COG2928) |
Kegg | Link to kegg annotations (AT2G20120) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019446336.1) |
Pfam | Protein of unknown function (DUF502) (PF04367.12) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer