Protein coding transcript 211449

• Transcript: Ll_transcript_60961
• CDS coordinates: 831-1262 (+)
• Peptide sequence: MTGCVILFPIAITFYITWWFIHFVDGFFSPIYAQLGIEVFGLGFVTSITFIFVVGVFMSSWLGASVLGLGEWFIKRMPLVRHIYNASKQISAAISPDQNTQAFKEVAIIRHPRIGEYAFGFITSSVVLQVSNQLLCLVAFKIA*
• ORF Type: complete

Annotations of Ll_transcript_60961

• Blastp: Protein CONTINUOUS VASCULAR RING 1 from Arabidopsis with 86.43% of identity
• Blastx: Protein CONTINUOUS VASCULAR RING 1 from Arabidopsis with 85.91% of identity
• Eggnog: conserved protein(COG2928)
• Kegg: Link to kegg annotations (AT2G20120)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019458476.1)
• Pfam: Protein of unknown function (DUF502) (PF04367.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;