Protein coding transcript 211508

• Transcript: Ll_transcript_61788
• CDS coordinates: 25-942 (+)
• Peptide sequence: MAMTSEIQSQLSKRNAVTIGGNLAVDGNKGGGAATALLKHQISPVSSIEFVASSGLRSLIGLQTSRNLSSHSAATLGIGMSLQDGSLNLSNLWTRQLSETASGHIQLDLGQQSSIAVGWQKKEERGSASGEVKIGTGSFDTTVRYTHRFSRNSLGCIGGRFGSSALELEVGGGRKISKFSTVRWMYTVGIQGIFWKFELFRGGQKLIIPVLLTRHLSPVFATGALVVPASLYFVLKNFCIKPYYLRRNKQKALENDEKTSNQVFACAFIQCAFLFLVCNYILLHVEHFFCCCLMSTSTLNTYILQ*
• ORF Type: complete

Annotations of Ll_transcript_61788

• Blastp: Chaperone protein dnaJ 13 from Arabidopsis with 63.88% of identity
• Blastx: Chaperone protein dnaJ 13 from Arabidopsis with 63.88% of identity
• Eggnog: ATP binding to DnaK triggers the release of the substrate protein, thus completing the reaction cycle. Several rounds of ATP-dependent interactions between DnaJ, DnaK and GrpE are required for fully efficient folding. Also involved, together with DnaK and GrpE, in the DNA replication of plasmids through activation of initiation proteins (By similarity)(COG0484)
• Kegg: Link to kegg annotations (AT2G35720)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019445060.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;