Protein coding transcript 211542

• Transcript: Ll_transcript_59477
• CDS coordinates: 3-431 (+)
• Peptide sequence: IPTKAKVSSSPRLSFSVKASLKDFGVAVVATAATAILSSNALAVEVLLGSDDGGLAFVPNEFSITAGEKIVFKNNAGFPHNVVFDEDEIPGGVDVSKISMSEEDLLNGPGETYSVTLSEKGSYSFYCSPHQGAGMKGKVTVN*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_59477

• Blastp: Plastocyanin, chloroplastic from Pisum with 76.76% of identity
• Blastx: Plastocyanin, chloroplastic from Lycopersicon with 75.36% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019435013.1)
• Pfam: Copper binding proteins, plastocyanin/azurin family (PF00127.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;