Transcript | Ll_transcript_59487 |
---|---|
CDS coordinates | 2384-2953 (+) |
Peptide sequence | MSLHVLEHKGYSNSYNQIINIVIDCKLLQGSSEIRSMIQEVSLEMTMESSKALKELGLSIKTMTRSSSADIHIANSKAASKRLKSLLQSSLREETDLLSVIPVGTVASLLIDITDFTEKLSDCVNYLASLTNFDGVETNKYPQISESLYCECSDPDPNIDTSHVVVILVEGSSEAKPCGKSLSVQHNNV* |
ORF Type | complete |
Blastp | Aluminum-activated malate transporter 2 from Arabidopsis with 44.12% of identity |
---|---|
Blastx | Aluminum-activated malate transporter 2 from Arabidopsis with 68.13% of identity |
Eggnog | aluminum-activated malate transporter(ENOG410XR8V) |
Kegg | Link to kegg annotations (AT1G08440) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019465184.1) |
Pfam | Aluminium activated malate transporter (PF11744.7) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer