Protein coding transcript 2116

• Transcript: Ll_transcript_324828
• CDS coordinates: 3-374 (+)
• Peptide sequence: EDKGLTLYETATNESFWDFLNGNHDSLIMFQEAMAADSHMFKLALKECKHVFENLESLVDVGGGTGMVTKLINEAFPHMKCVVFDQPQVVANCSANENLSFVGGDMFKSIPSADAILLKWVLHD
• ORF Type: internal

Annotations of Ll_transcript_324828

• Blastp: (+)-6a-hydroxymaackiain 3-O-methyltransferase 1 from Pisum with 75% of identity
• Blastx: (+)-6a-hydroxymaackiain 3-O-methyltransferase 1 from Pisum with 75% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (AAC49856)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019445690.1)
• Pfam: O-methyltransferase (PF00891.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;