Transcript | Ll_transcript_60141 |
---|---|
CDS coordinates | 190-489 (+) |
Peptide sequence | MSSSSERVDLDGNPIKPITICMIGAGGFIGSHLCEKIMNETPHKVLALDVYNDKIKHLLEPDNLPWHGRIHFHRLNIKHLLEPDNLPWHGRIHFHRLNIK |
ORF Type | 3prime_partial |
Blastp | UDP-D-apiose/UDP-D-xylose synthase 2 from Arabidopsis with 79.75% of identity |
---|---|
Blastx | UDP-D-apiose/UDP-D-xylose synthase 2 from Arabidopsis with 79.75% of identity |
Eggnog | Nad-dependent epimerase dehydratase(COG0451) |
Kegg | Link to kegg annotations (AT1G08200) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019453906.1) |
Pfam | NAD dependent epimerase/dehydratase family (PF01370.20) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer