Transcript | Ll_transcript_60096 |
---|---|
CDS coordinates | 782-1774 (+) |
Peptide sequence | MPGPVYSPNSLLMSSGISCIRKCSSQAANDSPIVGHALFTTLGSETSGGSVYTIGINEPLDLGPGILNTWSSIEEVASFKCTLWTAEHDYNRHRAVIGTNRGAASVDLETGTTSWFLRCKSDVFAQQIVNSGNVILCGLRNGAIVTVDFREKRERLSSRFIKHRIPYSSSNKKAGSSNKEWFELTGDIYPSHTIRMPRSISCLLSLQFDDQYFLASSMDGSMKLYDRRLLQRGAVQSYEGHVNSHTRVQLGVDPAERFVMSGGEDCSLRVWSIKSGELLFEDKFSDSVLSTVCYQTNKSFKEENENQNKHQSSLGAWLGSRDGLFYMHWP* |
ORF Type | complete |
Blastp | DDB1- and CUL4-associated factor 4 from Homo with 30.19% of identity |
---|---|
Blastx | DDB1- and CUL4-associated factor 4-like protein 2 from Homo with 25.93% of identity |
Eggnog | ddb1 and cul4 associated factor(ENOG410XQIU) |
Kegg | Link to kegg annotations (26094) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019426311.1) |
Pfam | WD domain, G-beta repeat (PF00400.31) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer