Protein coding transcript 211637

• Transcript: Ll_transcript_60096
• CDS coordinates: 782-1774 (+)
• Peptide sequence: MPGPVYSPNSLLMSSGISCIRKCSSQAANDSPIVGHALFTTLGSETSGGSVYTIGINEPLDLGPGILNTWSSIEEVASFKCTLWTAEHDYNRHRAVIGTNRGAASVDLETGTTSWFLRCKSDVFAQQIVNSGNVILCGLRNGAIVTVDFREKRERLSSRFIKHRIPYSSSNKKAGSSNKEWFELTGDIYPSHTIRMPRSISCLLSLQFDDQYFLASSMDGSMKLYDRRLLQRGAVQSYEGHVNSHTRVQLGVDPAERFVMSGGEDCSLRVWSIKSGELLFEDKFSDSVLSTVCYQTNKSFKEENENQNKHQSSLGAWLGSRDGLFYMHWP*
• ORF Type: complete

Annotations of Ll_transcript_60096

• Blastp: DDB1- and CUL4-associated factor 4 from Homo with 30.19% of identity
• Blastx: DDB1- and CUL4-associated factor 4-like protein 2 from Homo with 25.93% of identity
• Eggnog: ddb1 and cul4 associated factor(ENOG410XQIU)
• Kegg: Link to kegg annotations (26094)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019426311.1)
• Pfam: WD domain, G-beta repeat (PF00400.31)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;