Protein coding transcript 211658

• Transcript: Ll_transcript_59610
• CDS coordinates: 168-821 (+)
• Peptide sequence: MEDPLQHIDWDTFLNQLPQQLDLDFLFPHSENNNNSSSNNNPVVPTADDHNSSPNTVISQIENFLFSDDHANDVVSSDAEYDKLLAEFLVDEVPPGGESDGGSSGSDKDGAKDGAVGVTAEENGSGACLSKKERRQVRNRDAAVRSRERKKLYVKDLEVKSRYFEGECRRLGYLLQCCYAENHALRLCLQSRGAASGAPMTEQESAVLLMGKACESY*
• ORF Type: complete

Annotations of Ll_transcript_59610

• Blastp: bZIP transcription factor 50 from Oryza sativa with 45% of identity
• Blastx: bZIP transcription factor 50 from Oryza sativa with 61.54% of identity
• Eggnog: B-zip transcription factor(ENOG410YP7D)
• Kegg: Link to kegg annotations (4341554)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019461939.1)
• Pfam: Basic region leucine zipper (PF07716.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;