Protein coding transcript 2117

• Transcript: Ll_transcript_324829
• CDS coordinates: 3-371 (+)
• Peptide sequence: EDKGLTLYETATNESFWDFLNGNHDSLIMFQEAMAADSHMFKLALKECKHVFENLESLVDVGGGTGMVTKLINEAFPHMKCVVFDQPQVVANCLGTQNLTFVGGDMFESIPSGDAILLKGST*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_324829

• Blastp: Isoflavone 4'-O-methyltransferase from Lotus with 72.73% of identity
• Blastx: (+)-6a-hydroxymaackiain 3-O-methyltransferase 1 from Pisum with 71.43% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (BAC58013)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019450798.1)
• Pfam: O-methyltransferase (PF00891.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;