Protein coding transcript 211719

• Transcript: Ll_transcript_60596
• CDS coordinates: 48-1157 (+)
• Peptide sequence: MIITSELAMEKEKMDLKDEANGEEEEEEEDPSSSTLLDLTSYQLHDLDSVELPLTLTELDLTSNRLSTLDPRIQHLSLLNKLSLRQNLITDDAVLPLSSWTSLSQLQELVLRDNHLKKIPDVTIFKKLLVFDVSFNEITSLHGLSSVSNTLKELYVSKNEVPKIEEIHHFHQLSILELGSNKLRVMENLQNLTNLEELWLGRNRIKVINLCGLKCIKKISLQSNRLTTMTGLEGCIALEELYLSHNGISKMEGLSSLVNLRVLDVSSNKLTSIDDIQNLMQLEDLWLNDNQIESLEGISEAVAGSKEKLTTIYLEKNPCVSLFFSLTNLRFFWHIYICRLGRTNNVFHLFLVGSFISFSTIVLSCCQVI*
• ORF Type: complete

Annotations of Ll_transcript_60596

• Blastp: Protein phosphatase 1 regulatory subunit pprA from Dictyostelium with 41.86% of identity
• Blastx: Protein phosphatase 1 regulatory subunit 7 from Homo with 41.83% of identity
• Eggnog: leucine Rich Repeat(COG4886)
• Kegg: Link to kegg annotations (DDB_G0284039)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019446359.1)
• Pfam: Leucine Rich repeat (PF13516.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;