Transcript | Ll_transcript_60597 |
---|---|
CDS coordinates | 48-1157 (+) |
Peptide sequence | MIITSELAMEKEKMDLKDEANGEEEEEEEDPSSSTLLDLTSYQLHDLDSVELPLTLTELDLTSNRLSTLDPRIQHLSLLNKLSLRQNLITDDAVLPLSSWTSLSQLQELVLRDNHLKKIPDVTIFKKLLVFDVSFNEITSLHGLSSVSNTLKELYVSKNEVPKIEEIHHFHQLSILELGSNKLRVMENLQNLTNLEELWLGRNRIKVINLCGLKCIKKISLQSNRLTTMTGLEGCIALEELYLSHNGISKMEGLSSLVNLRVLDVSSNKLTSIDDIQNLMQLEDLWLNDNQIESLEGISEAVAGSKEKLTTIYLEKNPCVSLFFSLTNLRFFWHIYICRLGRTNNVFHLFLVGSFISFSTIVLSCCQVI* |
ORF Type | complete |
Blastp | Protein phosphatase 1 regulatory subunit pprA from Dictyostelium with 41.86% of identity |
---|---|
Blastx | Protein phosphatase 1 regulatory subunit 7 from Homo with 41.83% of identity |
Eggnog | leucine Rich Repeat(COG4886) |
Kegg | Link to kegg annotations (DDB_G0284039) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019446359.1) |
Pfam | Leucine Rich repeat (PF13516.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer