| Transcript | Ll_transcript_60636 |
|---|---|
| CDS coordinates | 217-672 (+) |
| Peptide sequence | MAKELGLGLEITELRLGLPGGEPMCVDKNEKKRVFSEIEGGGDENSSSDDRKMPTKNQMVGWPPVCSYRKKNSVNEASRPYVKVSMDGAPFLRKIDLGMHKGYSELALALEKLFGCHGIGEALKNADNCEQVPIYEDKDGDWMLIGDVPWE* |
| ORF Type | complete |
| Blastp | Auxin-induced protein 22A from Vigna with 77.22% of identity |
|---|---|
| Blastx | Auxin-induced protein 22A from Vigna with 77.22% of identity |
| Eggnog | - |
| Kegg | - |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019448128.1) |
| Pfam | AUX/IAA family (PF02309.15) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer