Protein coding transcript 211820

• Transcript: Ll_transcript_60180
• CDS coordinates: 320-1039 (+)
• Peptide sequence: MNLPIHRSHSVPDFTRDDNVGCMFGMVSTTPRLAEKTVTRTTPTSIPDDTVENEDGGEDIPEEEAVCRICMIELGEGTNTLKLECSCKGELSFAHRECAVKWFSIKGNRICDVCKQEVQNLPVTLLRIQTVRGHRDQEDEISQHRFWQDGSILIIVNTLAYFCFLEQLLVSKMGSSVVVMPLPFSCILGLLASVAARTMVRRKDVCVYATVQFALVVLAGQIFYSLVSSFCSRSCSVLC*
• ORF Type: complete

Annotations of Ll_transcript_60180

• Blastp: E3 ubiquitin-protein ligase MARCH7 from Rattus with 29.17% of identity
• Blastx: E3 ubiquitin-protein ligase MARCH7 from Rattus with 29.17% of identity
• Eggnog: (Membrane-Associated Ring finger (C3HC4))(COG5183)
• Kegg: Link to kegg annotations (311059)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019432271.1)
• Pfam: RING-variant domain (PF12906.6)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;