Protein coding transcript 211845

• Transcript: Ll_transcript_60433
• CDS coordinates: 201-1127 (+)
• Peptide sequence: MAKCKNSSKKLSYISVPSQIINSISSSSLQSLLDSSSTSKKSARNTFKIYRNPRLFFFTLFLLSLLAFFKFGSNLDIPFSPYPCAITTLPQFKDSYLHSKSNLGVVSNVGYSAHDAKEDEVLNGGGDDSSVSLSESLFANVQLQAQGPSGFESGEEVEKGEFWKQPNGLGYKPCLGFSRDYRRGSEGVLRDRRKYLMVVVSGGMNQQRNQIVDAVVIARILGAALVVPILQVNVIWGDESEFADIFDMEHFKSVLADDVRVVSALPSTHLMTRPVEGSPPLHVTPSWIRSRYLKRVRVYLSCDVLFMP*
• ORF Type: complete

Annotations of Ll_transcript_60433

• Blastp: Uncharacterized protein At1g04910 from Arabidopsis with 33.33% of identity
• Blastx: Uncharacterized protein At1g04910 from Arabidopsis with 32.13% of identity
• Eggnog: DUF246 domain-containing protein(ENOG410Z25U)
• Kegg: Link to kegg annotations (AT1G04910)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019433124.1)
• Pfam: GDP-fucose protein O-fucosyltransferase (PF10250.8)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;