Protein coding transcript 2119

• Transcript: Ll_transcript_324779
• CDS coordinates: 788-1417 (+)
• Peptide sequence: MGPGHSHYVQAQGLAKEIANLLDCTTWSGAGPGLMDAVTQGALLAGKPVGGFKIGKEAGEWKSSNYHPYLPTENYFTCRFFSARKHGLVDTVVRNNSFDKTAVVALPGGIGTLDEVFEMLALIQLERIGSKLPVPFMLMNYDSFYSKLLDFLNVCEEWGTVSEGEIAPLWKVCNSNSEALAYLEDFYSISSSDTSKNATKVYNTQELPS*
• ORF Type: complete

Annotations of Ll_transcript_324779

• Blastp: LOG family protein YJL055W from Saccharomyces with 37.93% of identity
• Blastx: -
• Eggnog: -
• Kegg: Link to kegg annotations (YJL055W)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019442875.1)
• Pfam: Possible lysine decarboxylase (PF03641.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;