Transcript | Ll_transcript_61011 |
---|---|
CDS coordinates | 671-1105 (-) |
Peptide sequence | MDEGTKISDHLSTLNNIVSELESIKVEIDDEDKTLKLILSLPSSYVHLKHVLMYGKESLSFEEVASKIISEERRIKSDESTSSSSMLLTRNGANGKKIHAKNLRCWKCGKSGHVKRKCPGGGVSETEESTSNVSLVLRDENDLI* |
ORF Type | complete |
Blastp | Retrovirus-related Pol polyprotein from transposon TNT 1-94 from Nicotiana with 29.27% of identity |
---|---|
Blastx | Retrovirus-related Pol polyprotein from transposon TNT 1-94 from Nicotiana with 41.41% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_012574074.1) |
Pfam | gag-polypeptide of LTR copia-type (PF14223.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer