Protein coding transcript 211953

• Transcript: Ll_transcript_61017
• CDS coordinates: 635-1099 (-)
• Peptide sequence: MDEGTKISDHLSTLNNIVSELESIKVEIDDEDKTLKLILSLPSSYVHLKHVLMYGKESLSFEEVASKIISEERRIKSDESTSSSSMLLTRNGANGKKIHAKNLRCWKCGKSGHVKRKCPSGGVSEKDSEESASNVPLFWEMIWNIKFIIMVFPL*
• ORF Type: complete

Annotations of Ll_transcript_61017

• Blastp: Retrovirus-related Pol polyprotein from transposon TNT 1-94 from Nicotiana with 33.09% of identity
• Blastx: Retrovirus-related Pol polyprotein from transposon TNT 1-94 from Nicotiana with 41.41% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_012574320.1)
• Pfam: gag-polypeptide of LTR copia-type (PF14223.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;