Protein coding transcript 211973

• Transcript: Ll_transcript_59641
• CDS coordinates: 357-698 (+)
• Peptide sequence: MSQGLRGSPQNTGLSFINGRGLSRMDDLRQVEAKYPALLFKQHLTAFLEKIYGMIRDSLKKEISPLLGLCIQAPRTVRQSAVKGRSHANAVAQQALIAHWQSIVKSLNNYLKIM
• ORF Type: 3prime_partial

Annotations of Ll_transcript_59641

• Blastp: Myosin-17 from Arabidopsis with 83.33% of identity
• Blastx: Myosin-17 from Arabidopsis with 68.1% of identity
• Eggnog: myosin heavy chain(COG5022)
• Kegg: Link to kegg annotations (AT5G20490)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019463633.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;