Transcript | Ll_transcript_59645 |
---|---|
CDS coordinates | 220-936 (+) |
Peptide sequence | MFNPFQRYLMMLAKAEAGKKSSEGSDNHKKLLKDVETISKVLYPDENSYKNSASTAISQSKSTKIFPLPDPKSKPKASVDDKSVKDKKSIWNWKRLKALSINHSRKFNCCFSIQVHLIEGLPLSFNDASLRVYWKRQDEVMVTHPAKVIQCTAEFEEILNHTCSISGSRSAPHNSAKYEAKHVLLYASVVGAPELDLGKHRVDLARLLPLTLEELEEEKSSGKWTTSFRLSGAARGATM |
ORF Type | 3prime_partial |
Blastp | Protein PLASTID MOVEMENT IMPAIRED 1-RELATED 1 from Arabidopsis with 54.75% of identity |
---|---|
Blastx | Protein PLASTID MOVEMENT IMPAIRED 1-RELATED 1 from Arabidopsis with 52.94% of identity |
Eggnog | NA(ENOG410Y9MA) |
Kegg | Link to kegg annotations (AT5G20610) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019463634.1) |
Pfam | N-terminal C2 in EEIG1 and EHBP1 proteins (PF10358.8) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer