Protein coding transcript 212

• Transcript: Ll_transcript_470260
• CDS coordinates: 56-847 (+)
• Peptide sequence: MAESAPTNTGLKLAGKVAIVTGGTGGIGETTARVFADHGARMVVIADIQDELGKQIATSIGADKCTYVHCDVADEDQVRNLVQSTVNIYGQIDIMFSNAGILSPSEPTILDIDMTELSRLFAVNALGMAACVKHAARAMVEKKVRGSIVCTASVSASYGGTADTDYIMSKHAVLGLMRAASIQLGGYGIRVNSVSPNGLATPMTCERLGSEEKVQEAYEKCAWLKGLVLTTKHVADAVLFLASNDSEFVSGHDLLVDGSYIVT*
• ORF Type: complete

Annotations of Ll_transcript_470260

• Blastp: (-)-isopiperitenol/(-)-carveol dehydrogenase, mitochondrial from Mentha with 56.85% of identity
• Blastx: (-)-isopiperitenol/(-)-carveol dehydrogenase, mitochondrial from Mentha with 56.85% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (AAU20370)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019429491.1)
• Pfam: short chain dehydrogenase (PF00106.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;