Protein coding transcript 2120

• Transcript: Ll_transcript_324782
• CDS coordinates: 1-303 (+)
• Peptide sequence: QDDTEGTKRSYECTFCKRGFTNAQALGGHMNIHRKDRAKAKKVITNQTNEDYSMAPPFASGFSNQTTRHFSILESQSICDMYFHPPPPPNLFRDQPPYAPN
• ORF Type: internal

Annotations of Ll_transcript_324782

• Blastp: Transcriptional regulator TAC1 from Arabidopsis with 55.93% of identity
• Blastx: Transcriptional regulator TAC1 from Arabidopsis with 55.93% of identity
• Eggnog: ZnF_C2H2(ENOG4111ECK)
• Kegg: Link to kegg annotations (AT3G09290)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019460483.1)
• Pfam: C2H2-type zinc finger (PF13912.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;