Protein coding transcript 212065

• Transcript: Ll_transcript_60364
• CDS coordinates: 1148-1819 (+)
• Peptide sequence: MEDNPSHIFLLNCDVCCSFPLSSMLEAHRRYGGMGTMLVIKVSNLINCGVYIFTPEIFNAIEDVSMNREGRANLRRVSSFEALQSATRTLPSDFVRLDQDILSPLAGKKQLYTYETMDFWEQIKTPGMSLKCSELYLAQFRYTSPHLLASGDGKKNSTIVGDVYIHPSAKVHPSAKIGPNVSISANVRVGAGVRLISCIILDDVEIKENALVLNSIVGWKSSIG
• ORF Type: 3prime_partial

Annotations of Ll_transcript_60364

• Blastp: Mannose-1-phosphate guanyltransferase alpha-B from Danio with 40.08% of identity
• Blastx: Mannose-1-phosphate guanyltransferase alpha-B from Danio with 40.45% of identity
• Eggnog: nucleotidyl transferase(COG1208)
• Kegg: Link to kegg annotations (393469)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019452921.1)
• Pfam: Bacterial transferase hexapeptide (six repeats) (PF00132.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;