| Transcript | Ll_transcript_60365 |
|---|---|
| CDS coordinates | 2-310 (+) |
| Peptide sequence | FPLSSMLEAHRRYGGMGTMLVIKVGALKHYCMYNCISMCDSVHADGDILCVSLHHNFFSFSFRGWGCHVQVSAESANEFGELVADPTTNELLHYTEKPETFMS |
| ORF Type | internal |
| Blastp | Mannose-1-phosphate guanyltransferase alpha from Dictyostelium with 40.98% of identity |
|---|---|
| Blastx | - |
| Eggnog | nucleotidyl transferase(COG1208) |
| Kegg | Link to kegg annotations (DDB_G0271858) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019442602.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer