Protein coding transcript 212156

• Transcript: Ll_transcript_59688
• CDS coordinates: 191-505 (+)
• Peptide sequence: MGAGGRTSVPPPSRKSENDSVNRVPFEKPPFSLSQVKKAIPPHCFKRSILRSFSYVVYDLTIASILYYVATHYFHQLPSPFSSLAWPIYWAIQGCVLTGVWVIAH
• ORF Type: 3prime_partial

Annotations of Ll_transcript_59688

• Blastp: Omega-6 fatty acid desaturase, endoplasmic reticulum isozyme 2 from Soja with 78.1% of identity
• Blastx: Omega-6 fatty acid desaturase, endoplasmic reticulum isozyme 2 from Soja with 78.1% of identity
• Eggnog: linoleoyl-CoA desaturase activity(COG3239)
• Kegg: Link to kegg annotations (547815)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019440821.1)
• Pfam: Domain of unknown function (DUF3474) (PF11960.7)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;