Protein coding transcript 212181

• Transcript: Ll_transcript_61558
• CDS coordinates: 2-367 (+)
• Peptide sequence: LYVFTLTLPSSSAVYWAFGDELLNHSNAFSLLPKNGFRDAAVILMLIHQFITFGFACTPLYFVWEKVIGMHNTRSICVRALARLPVVIPIWFLAIIFPFFGPINSAVGALLVSFTVYIIPSL
• ORF Type: internal

Annotations of Ll_transcript_61558

• Blastp: Auxin transporter-like protein 2 from Medicago with 94.21% of identity
• Blastx: Auxin transporter-like protein 2 from Medicago with 94.21% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (MTR_7g067450)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019450308.1)
• Pfam: Transmembrane amino acid transporter protein (PF01490.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;