Protein coding transcript 212241

• Transcript: Ll_transcript_60062
• CDS coordinates: 351-1244 (+)
• Peptide sequence: MITESFFLLLYRFSGLQRCGKSCRLRWLNYLRPNVRRGNFTQEEEEIIIRLHNKLGNRWSIIATHLSGRTDNEIKNHWHTSLKKSIQQNTVTKEKAKSPFKPKDIESNPASYSVSNNVALQVTPPSTTSQISDSTTGSLSPPSSISSEFSSSISWDDTSSTTKLVIEDDFPFLDDAFWIESDLADISNIHSEIIQGGYYNDAFQSVEPIDILVALSPHPLSNKNIVMESDFGSFVYVDTEATMNHLWTQSFVSDTCQVPSQLIKPLEAESQYFSQAYGSESDFWSQNNLCDEHLSLF*
• ORF Type: complete

Annotations of Ll_transcript_60062

• Blastp: Transcription factor MYB15 from Arabidopsis with 43.24% of identity
• Blastx: Transcription factor MYB4 from Oryza sativa with 47.5% of identity
• Eggnog: Myblike DNAbinding domain containing protein(COG5147)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019452015.1)
• Pfam: Myb-like DNA-binding domain (PF13921.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;