Protein coding transcript 212251

• Transcript: Ll_transcript_60301
• CDS coordinates: 129-1265 (+)
• Peptide sequence: MVKDSNPLSYGAENGEQGSFDPSAPPPFKIAEIRASIPKHCWVKNPWKSLSYVLRDVVVVTALIGAAIWFNSWFFWPLYWVAQGTMFWAIFVLGHDCGHGSFSDSSKLNSIVGHILHSSILVPYHGWRISHKTHHQNHGHVEKDESWVPLPEKIYKTLDDTTKLLRFTLPFPVFAYPFYLWYRSPGKEGSHFNPYSNLFSPSDRKDVLTSTICWSIMFSVLLYLSFTLGPFLVFKVYWVPYLVFVMWLDFVTYLHHHGYKQKLPWYRGQEWDYLRGGLTTVDRDYGWVNSIHHDIGTHVIHHLFPQIPHYHLIEATEAAKPVLGKYYREPEKSGPIPFHLIKYLLLSIKQDHFVSDTGDIVYYQNDPKLQKYSFTKFE*
• ORF Type: complete

Annotations of Ll_transcript_60301

• Blastp: Omega-3 fatty acid desaturase, endoplasmic reticulum from Vigna with 80.05% of identity
• Blastx: Omega-3 fatty acid desaturase, endoplasmic reticulum from Vigna with 80.05% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019447010.1)
• Pfam: Domain of unknown function (DUF3474) (PF11960.7)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;