Protein coding transcript 212252

• Transcript: Ll_transcript_60302
• CDS coordinates: 408-947 (+)
• Peptide sequence: MIKCLLVCVCVSFSQLTESLYKSLDNVSRMMRFTVPFPMLAYPFYLWRRSPGKVGSHYNPYSNLFTPNERKEVVISTICWFSMLSMLLYLSTIISPILLLKVYGIPYWINVMWLDLVTYLHHHGYKQKLPWYRGKEWSYLRGGLTTVDRDYGWINNIHHDIGTHVIHHLFPQTPHYHLIE
• ORF Type: 3prime_partial

Annotations of Ll_transcript_60302

• Blastp: Omega-3 fatty acid desaturase, endoplasmic reticulum from Soja with 75.15% of identity
• Blastx: Omega-3 fatty acid desaturase, endoplasmic reticulum from Soja with 62.91% of identity
• Eggnog: linoleoyl-CoA desaturase activity(COG3239)
• Kegg: Link to kegg annotations (100038323)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (NP_001236943.1)
• Pfam: Fatty acid desaturase (PF00487.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;