Protein coding transcript 212253

• Transcript: Ll_transcript_60305
• CDS coordinates: 156-464 (+)
• Peptide sequence: MLNSIVGHILHSSILVPYHGWFVLYSFCFLFFHFVHQVFHINKIFKSDLTAILFCFVAGELVIEHIIRIMGMLRMMSHGFQYVFLAFTIVLISNVLVGPTKN*
• ORF Type: complete

Annotations of Ll_transcript_60305

• Blastp: Omega-3 fatty acid desaturase, chloroplastic from Sesamum with 95% of identity
• Blastx: Omega-3 fatty acid desaturase, endoplasmic reticulum from Soja with 61.43% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (105167042)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (NP_001236943.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;