Transcript | Ll_transcript_60325 |
---|---|
CDS coordinates | 129-902 (+) |
Peptide sequence | MVKDSNPLSYGAENGEQGSFDPSAPPPFKIAEIRASIPKHCWVKNPWKSLSYVLRDVVVVTALIGAAIWFNSWFFWPLYWVAQGTMFWAIFVLGHDCGHGSFSDSSKLNSIVGHILHSSILVPYHGWRISHKTHHQNHGHVEKDESWVPLPEKIYKTLDDTTKLLRFTLPFPVFAYPFYLWYRSPGKEGSHFNPYSNLFSPSDRKDVLTSTICWSIMFSVLLYLSFTLGPFLVFKVYWVPYLVIITLRHSLFYNLIS* |
ORF Type | complete |
Blastp | Omega-3 fatty acid desaturase, endoplasmic reticulum from Vigna with 76.6% of identity |
---|---|
Blastx | Omega-3 fatty acid desaturase, endoplasmic reticulum from Vigna with 70.83% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019447010.1) |
Pfam | Domain of unknown function (DUF3474) (PF11960.7) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer