Protein coding transcript 212306

• Transcript: Ll_transcript_61286
• CDS coordinates: 205-573 (+)
• Peptide sequence: MVGNLLTPDGKPDEQALKGLFEKIDRNRDSCISESELKELIMNIKFVKVSMEVEDAVALVIEELDFNRDQIINEEEFVDGFQKWLGSTSSPAPVSNSESLQDIYQVSICTIPFVQTQPSKHS*
• ORF Type: complete

Annotations of Ll_transcript_61286

• Blastp: Sodium/calcium exchanger NCL1 from Oryza sativa with 36.73% of identity
• Blastx: Sodium/calcium exchanger NCL1 from Oryza sativa with 37.69% of identity
• Eggnog: Calcium-binding EF hand family protein(ENOG410ZVKW)
• Kegg: Link to kegg annotations (4325568)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019443894.1)
• Pfam: EF-hand domain pair (PF13499.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;