Transcript | Ll_transcript_61293 |
---|---|
CDS coordinates | 603-971 (+) |
Peptide sequence | MVGNLLTPDGKPDEQALKGLFEKIDRNRDSCISESELKELIMNIKFVKVSMEVEDAVALVIEELDFNRDQIINEEEFVDGFQKWLGSTSSPAPVSNSESLQDIYQVSICTIPFVQTQPSKHS* |
ORF Type | complete |
Blastp | Sodium/calcium exchanger NCL1 from Oryza sativa with 36.73% of identity |
---|---|
Blastx | Sodium/calcium exchanger NCL from Arabidopsis with 40.48% of identity |
Eggnog | Calcium-binding EF hand family protein(ENOG410ZVKW) |
Kegg | Link to kegg annotations (4325568) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019443894.1) |
Pfam | EF-hand domain pair (PF13499.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer