Protein coding transcript 212323

• Transcript: Ll_transcript_61302
• CDS coordinates: 2-703 (+)
• Peptide sequence: NLRILYPIFPLLSSSEMRYNIFKTPYFIFLLLLLVKTVKIQCRYVPYQASELVSDGVESNKTSSNYLVLKEIDEAFEEQCKQMYGFLPCTNSIFGDLFLILVYEYLLFHGESYLARGGEQIFKILGPGIFGASAFHIIGALPESLILLVSGLLSNGEVAQEYAFTGVGLLAGSSIMLLTLVWGSCVIAGKQEFQHQSRSRIYQGSSSAQKSIKTLFNGLLHFTLICFSLILFQ*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_61302

• Blastp: Sodium/calcium exchanger NCL from Arabidopsis with 42.76% of identity
• Blastx: Sodium/calcium exchanger NCL from Arabidopsis with 42.11% of identity
• Eggnog: Calcium-binding EF hand family protein(ENOG410ZVKW)
• Kegg: Link to kegg annotations (AT1G53210)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019443894.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;