Protein coding transcript 212371

• Transcript: Ll_transcript_61210
• CDS coordinates: 1243-1830 (+)
• Peptide sequence: MTKTEEKDILKGITGAVNPGEVLALMGPSGSGKTSLLNLIGGRLSHPTISGTISYNDQPYSKCLKSRIGFVTQDDVLSPHLTVKETLTYAARLKLPKTLTREQKEKRALDVIYELGLERCQDTMIGGSFIRGVSGGERKRVCVGNEIIINPSLLFLDEPTSGLDSTTALKMVQMLHDIAEAGKTVVTTIHQPSSRL
• ORF Type: 3prime_partial

Annotations of Ll_transcript_61210

• Blastp: ABC transporter G family member 22 from Arabidopsis with 80.1% of identity
• Blastx: ABC transporter G family member 22 from Arabidopsis with 79.05% of identity
• Eggnog: (ABC) transporter(COG1131)
• Kegg: Link to kegg annotations (AT5G06530)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019456693.1)
• Pfam: ABC transporter (PF00005.26)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;