Protein coding transcript 212388

• Transcript: Ll_transcript_61183
• CDS coordinates: 109-519 (+)
• Peptide sequence: MEKANSLGLLRTKSDQLVESIAAAFKSPQSSDHSTNEMVDGAGTMSRKSSRRLIPASPGRGGGKNTHIRKSRSAQISQMKFELDEVSSGAALSRASSASLGLSFSFTGFAMPPDEIADSKPFSDDDIRKFHISLIS*
• ORF Type: complete

Annotations of Ll_transcript_61183

• Blastp: ABC transporter G family member 22 from Arabidopsis with 65.08% of identity
• Blastx: ABC transporter G family member 22 from Arabidopsis with 63.24% of identity
• Eggnog: (ABC) transporter(COG1131)
• Kegg: Link to kegg annotations (AT5G06530)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019428047.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;