Protein coding transcript 2124

• Transcript: Ll_transcript_324827
• CDS coordinates: 378-740 (+)
• Peptide sequence: MASRNYSYNYSTTTTFLIIVLLLLHLMCTVSQRDLLFEEKNRLGSSPPRCHNKCNDCNPCMAVQVPSLPSHEQQLQQDLTKKDTMEEALFDPSTQVNNNRYSNYKPLGWKCHCGNHFFDP*
• ORF Type: complete

Annotations of Ll_transcript_324827

• Blastp: EPIDERMAL PATTERNING FACTOR-like protein 1 from Arabidopsis with 45.16% of identity
• Blastx: EPIDERMAL PATTERNING FACTOR-like protein 1 from Arabidopsis with 45.16% of identity
• Eggnog: epidermal patterning factor-like protein(ENOG410Z50T)
• Kegg: Link to kegg annotations (AT5G10310)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019459785.1)
• Pfam: Epidermal patterning factor proteins (PF17181.3)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;