Transcript | Ll_transcript_61698 |
---|---|
CDS coordinates | 643-1224 (+) |
Peptide sequence | MGATLKASSIIALSRYLTVQFVRFFWKRESNQKAKILRKVDYPLVLDVYDFCSDDLRKKLDAPRQILRNEEGKKFGLKVSEKSSVDKNSDAQMPDAEGSSNGGGDPSIAPMEEGEKETQMTGIYDLVAVLTHKGRSADSGHYVGWVKQENGKWIEYDDDNPKPRVEDDITKLSGGGDWHMAYIIMYKARVVSV* |
ORF Type | complete |
Blastp | Ubiquitin carboxyl-terminal hydrolase 6 from Arabidopsis with 74.48% of identity |
---|---|
Blastx | Ubiquitin carboxyl-terminal hydrolase 6 from Arabidopsis with 74.48% of identity |
Eggnog | ubiquitin thiolesterase activity(ENOG410XP96) |
Kegg | Link to kegg annotations (AT1G51710) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019424795.1) |
Pfam | Ubiquitin carboxyl-terminal hydrolase (PF00443.28) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer