Protein coding transcript 212415

• Transcript: Ll_transcript_61698
• CDS coordinates: 643-1224 (+)
• Peptide sequence: MGATLKASSIIALSRYLTVQFVRFFWKRESNQKAKILRKVDYPLVLDVYDFCSDDLRKKLDAPRQILRNEEGKKFGLKVSEKSSVDKNSDAQMPDAEGSSNGGGDPSIAPMEEGEKETQMTGIYDLVAVLTHKGRSADSGHYVGWVKQENGKWIEYDDDNPKPRVEDDITKLSGGGDWHMAYIIMYKARVVSV*
• ORF Type: complete

Annotations of Ll_transcript_61698

• Blastp: Ubiquitin carboxyl-terminal hydrolase 6 from Arabidopsis with 74.48% of identity
• Blastx: Ubiquitin carboxyl-terminal hydrolase 6 from Arabidopsis with 74.48% of identity
• Eggnog: ubiquitin thiolesterase activity(ENOG410XP96)
• Kegg: Link to kegg annotations (AT1G51710)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019424795.1)
• Pfam: Ubiquitin carboxyl-terminal hydrolase (PF00443.28)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;