Protein coding transcript 212447

• Transcript: Ll_transcript_59552
• CDS coordinates: 537-1061 (+)
• Peptide sequence: MLAAILAGLARPRDCKRIYLVAVIGSSHDETFLLQSEDSKIGGFVGKFSHKKGYVAGILTVDNFAEFLPRKGPRRRRRTGIAYIANVAVRENFRGKGIAKKLIAKAESKARSWGCSAIALHCDLNNPMATKLYQGQGFKCIKVPEGAKWPQPKTSTDIKFNFMMKLLNNSVACN*
• ORF Type: complete

Annotations of Ll_transcript_59552

• Blastp: N-alpha-acetyltransferase 30 from Saccharomyces with 39.13% of identity
• Blastx: -
• Eggnog: -
• Kegg: Link to kegg annotations (YPR051W)
• CantataDB: Link to cantataDB annotations (CNT0001094)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019449804.1)
• Pfam: Acetyltransferase (GNAT) family (PF00583.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;