Protein coding transcript 212488

• Transcript: Ll_transcript_61152
• CDS coordinates: 730-1479 (+)
• Peptide sequence: MASVKFGSKADAFRRQGQAWFCTTGLPSDLVVEVGEMSFHLHKFPLLSKSGVLFRLITEASESEEEEECVIHPPDIPGGAKTFELVAKFCYGVKLELTASNFVNLWCAAEHLEMTEEHGEGNLISQAETFFNQVVVRSWKDSVRALQTCDDVLPHAEVLHIVKRCIESLAAKASTDPNLFGWPVLERGGPMQSPGGSVLWNGISTGARPKNPSSDWWYEDVANLSLPLYKRLIAVMESRGIMLKGTCQG*
• ORF Type: complete

Annotations of Ll_transcript_61152

• Blastp: BTB/POZ domain-containing protein At1g30440 from Arabidopsis with 78.01% of identity
• Blastx: BTB/POZ domain-containing protein At1g30440 from Arabidopsis with 77.59% of identity
• Eggnog: BTB POZ domain-containing protein(ENOG410ZHWZ)
• Kegg: Link to kegg annotations (AT1G30440)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019415117.1)
• Pfam: BTB/POZ domain (PF00651.30)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;