Protein coding transcript 212496

• Transcript: Ll_transcript_61114
• CDS coordinates: 3241-3849 (+)
• Peptide sequence: MIIFLRGSLGFGEEALQSLLGNIGSQDVNDVLNAIDHVITLGLANPSKIAVLGGSHGGFLTTHLIGQAPEKFVAAAARNPVCNLALMTGTTDIPDWCYAETYGTIGSEKFTEAPSVDDLAQFYSKSPISHISKVKTPTLLLLGAQDLRVPVTNGLQYARALREKGVPHKVIVFPNDVHGIDRPQSDFESFLNIGVWFNKYCK*
• ORF Type: complete

Annotations of Ll_transcript_61114

• Blastp: Acylamino-acid-releasing enzyme 1 from Oryza sativa with 75% of identity
• Blastx: Acylamino-acid-releasing enzyme 1 from Oryza sativa with 75% of identity
• Eggnog: peptidase s9 prolyl oligopeptidase active site domain protein(COG1506)
• Kegg: Link to kegg annotations (4348626)
• CantataDB: Link to cantataDB annotations (CNT0002022)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019413665.1)
• Pfam: Prolyl oligopeptidase family (PF00326.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;