Protein coding transcript 212502

• Transcript: Ll_transcript_61120
• CDS coordinates: 1384-1821 (+)
• Peptide sequence: MSSLKFNVMKIPVKGASVSPTTGAHKPYETIFVSSKAKKSDTCDPLIVILHGGPHSTSLTSFSKSLAFLSALGYSLLIVNYRGSLGFGEEALQSLLGKIGSQDVNDVLNAIDHVINLGLASPSKIAVLGGSHGGFLTTHLIGQAPE
• ORF Type: 3prime_partial

Annotations of Ll_transcript_61120

• Blastp: Acylamino-acid-releasing enzyme from Arabidopsis with 62.59% of identity
• Blastx: Acylamino-acid-releasing enzyme 1 from Oryza sativa with 57.09% of identity
• Eggnog: peptidase s9 prolyl oligopeptidase active site domain protein(COG1506)
• Kegg: Link to kegg annotations (AT4G14570)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019449915.1)
• Pfam: Carboxylesterase family (PF00135.27)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;