Protein coding transcript 212521

• Transcript: Ll_transcript_60936
• CDS coordinates: 2002-2445 (+)
• Peptide sequence: MTSSIFSKGLPTLHSSRYHIHHQSSSVVEDELDPFSLVADELSLVSNKLRAMVVAEVPKLASAAEYFFKMGVEGKRFRPTVLLLMSTALNLPIPNASPPIELDDTLATDLRSRQQCIAEITEMIHSWLQLSIIDNICAYKAKPTLVV*
• ORF Type: complete

Annotations of Ll_transcript_60936

• Blastp: Solanesyl diphosphate synthase 3, chloroplastic/mitochondrial from Arabidopsis with 58.27% of identity
• Blastx: Solanesyl diphosphate synthase 3, chloroplastic/mitochondrial from Arabidopsis with 83.46% of identity
• Eggnog: synthase(COG0142)
• Kegg: Link to kegg annotations (AT2G34630)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019422348.1)
• Pfam: Polyprenyl synthetase (PF00348.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;